PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009142197.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Nin-like
Protein Properties Length: 781aa    MW: 86490.5 Da    PI: 6.1022
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009142197.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK88.17.5e-28479529252
          RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     e ++sl +l+++Fs+++kdAA+++gvc+T+LKriCRq+GI+RWP+Rki+++
  XP_009142197.1 479 ERNVSLRVLQQHFSGSLKDAARSIGVCPTTLKRICRQHGIMRWPSRKINKV 529
                     6799*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.381466549IPR003035RWP-RK domain
PfamPF020425.7E-26481529IPR003035RWP-RK domain
SuperFamilySSF542779.16E-22669764No hitNo description
Gene3DG3DSA:3.10.20.2401.9E-22678759No hitNo description
SMARTSM006665.5E-22680762IPR000270PB1 domain
PROSITE profilePS5174519.962680762IPR000270PB1 domain
CDDcd064078.91E-33681761No hitNo description
PfamPF005643.2E-17681761IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 781 aa     Download sequence    Send to blast
MEQHPFASRE NGFGYQEHMD GLTIGSGVWS FISDDMLNSS PTSELMNFNS FPTWCNIPFD  60
TDMLFSQYGQ EMSSRSHHHS FDIDELSGKR RSVLNCTIPR SLSHSLDEKM LKALSLFMQF  120
SGSGDGVLAQ VWTPVKTGDQ NMLSTCGQAY LLDPRLSQYR EVSRKFTFAS KPNQSSYPGL  180
PGRVFISGVR EWTPNVMYYK KDEYLRVKHA IDNEVRGSIA IPILEASGAS CCAVMELVTS  240
DEKLSFDVEL DSVCRALQAV DLRTSVVPRP QYLSSNQRDA LAEIQDVLRA LCHAHKLPLA  300
LTWIPNSGVL CIEETACYVN DMDMEGFVHA CLDHPLREKE GIVGKAFVSN QPSFSSDVKA  360
YDISEYPLVH HARKHGLNAA VALKLRSTYT GEDDYILELF LPLSLKGSLE QQLLLDSLEG  420
TLQRVCRTLR TVSDVEATSS TPSIFSDKSS DKDSTGSQGT CEQDMSKART AERTKGATER  480
NVSLRVLQQH FSGSLKDAAR SIGVCPTTLK RICRQHGIMR WPSRKINKVN RSLRKIQTVL  540
DSVHGIEGGL RFDSATGEFV AVCSSNGNNA HVMAEDASCE FLKPESVDNT IKLEDDIITN  600
GSFMEVNASD QPCALKAEQS GFNGSSQEIA SGNIIEPNRS MSDSSHGSGA VMLRSSSPSM  660
DDRNQRRAHK SNSSESGSAT LTVKATYRED TTRFKFDPSV GCLQLYKEVG KRFRLQEGLF  720
QLKYFDDEEE WVMLVTDSDL QECLEMLVGM KKQTVKFLVR DLPAARIGSS AGSNGYLGAG  780
L
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009142196.10.0PREDICTED: protein NLP8-like isoform X1
RefseqXP_009142197.10.0PREDICTED: protein NLP8-like isoform X1
RefseqXP_009142198.10.0PREDICTED: protein NLP8-like isoform X1
SwissprotO228640.0NLP8_ARATH; Protein NLP8
TrEMBLM4F9E80.0M4F9E8_BRARP; Uncharacterized protein
STRINGBra037711.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43500.20.0Nin-like family protein